PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00066.97
Common NameAMTR_s00066p00109320, LOC18448591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 221aa    MW: 26079.5 Da    PI: 8.4622
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00066.97genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.41.7e-27959151
                                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                   SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                             krien +nrqvt+skRr+gi KKA EL vLCda+v++i+fs+tgkl ey+s
  evm_27.model.AmTr_v1.0_scaffold00066.97  9 KRIENPTNRQVTYSKRRAGITKKARELAVLCDAQVSLIMFSTTGKLSEYCS 59
                                             79***********************************************96 PP

2K-box821.3e-27711701100
                                    K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                                              yq+ s+++l+++++e++q el+ Lk+e++ Lq+ +R+ +Ge+L++L  k+L+ Leq+Le+ +k+iR+kKn
  evm_27.model.AmTr_v1.0_scaffold00066.97  71 YQRVSDTNLWDTHYERMQSELSSLKEENNRLQKLIRQKMGEELNELRWKDLRDLEQNLEEWVKRIRDKKN 140
                                              78889999************************************************************** PP

                                    K-box  71 ellleqieelqkkekelqeenkaLrkklee 100
                                              +ll++q+++ +k+ ++l+ en+++r ++ee
  evm_27.model.AmTr_v1.0_scaffold00066.97 141 QLLTNQTDTCRKRINKLEAENNTIRLQMEE 170
                                              ************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.357161IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-37295IPR002100Transcription factor, MADS-box
CDDcd002651.75E-40280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-27323IPR002100Transcription factor, MADS-box
PfamPF003198.6E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-273859IPR002100Transcription factor, MADS-box
PfamPF014864.3E-2281168IPR002487Transcription factor, K-box
PROSITE profilePS5129715.86984174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRGKIEIKR IENPTNRQVT YSKRRAGITK KARELAVLCD AQVSLIMFST TGKLSEYCSP  60
STSPKEIYDR YQRVSDTNLW DTHYERMQSE LSSLKEENNR LQKLIRQKMG EELNELRWKD  120
LRDLEQNLEE WVKRIRDKKN QLLTNQTDTC RKRINKLEAE NNTIRLQMEE EVAHCFDDET  180
DCESTLVLGS RNMQLFTYLQ PENRQNLRVR GFPSEDLRLG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3377440.0AY337744.1 Amborella trichopoda APETALA3-like protein AP3-2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006858714.11e-162PREDICTED: MADS-box transcription factor 16 isoform X1
TrEMBLU5D3L01e-162U5D3L0_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr9P20950_0012e-72(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.13e-53MIKC_MADS family protein
Publications ? help Back to Top
  1. Kim S, et al.
    Phylogeny and diversification of B-function MADS-box genes in angiosperms: evolutionary and functional implications of a 260-million-year-old duplication.
    Am. J. Bot., 2004. 91(12): p. 2102-18
    [PMID:21652358]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]